PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011081057.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 285aa    MW: 32371.6 Da    PI: 7.1889
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011081057.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.6e-072342672154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp+++++++L +++gL+ +q+ +WF N+R +
  XP_011081057.1 234 KWPYPTEDDKAKLVEQTGLQLKQINNWFINQRKR 267
                     468*****************************87 PP

2ELK25.52.9e-09188209122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK +L++++++++ ++++E++
  XP_011081057.1 188 ELKIELKQGFKSRIEDVREEIL 209
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.1E-193175IPR005540KNOX1
PfamPF037901.2E-173374IPR005540KNOX1
SMARTSM012563.4E-2587142IPR005541KNOX2
PfamPF037911.0E-1892141IPR005541KNOX2
PROSITE profilePS512139.132188208IPR005539ELK domain
PROSITE profilePS5007111.677208271IPR001356Homeobox domain
SuperFamilySSF466892.57E-16210275IPR009057Homeodomain-like
SMARTSM003891.6E-10210275IPR001356Homeobox domain
CDDcd000869.63E-11211272No hitNo description
Gene3DG3DSA:1.10.10.604.0E-25215274IPR009057Homeodomain-like
PfamPF059201.1E-17228267IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MQEQGMGMMG CGGIGGGLTD VSMAVPGEQH HQLKAEIATH PLYEQLLSAH VSCLRVATPI  60
DQLPLIDAQL SQSHHLLRSY AQNNAHHSLP QHQRQELDNF LAQYMLVLCS FREQLQQHVR  120
VHAVEAVMAC REIEQNLQSL TGATLAEGTG ATMSDDEDEL QMDFSFDQSG GDGQDLMGFG  180
PLQRVRQELK IELKQGFKSR IEDVREEILR KRRAGKLPGD TTTVLKNWWQ QHSKWPYPTE  240
DDKAKLVEQT GLQLKQINNW FINQRKRNWH SNSQSATSLK SKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13211267864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264284RKRNWHSNSQSATSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081057.10.0PREDICTED: homeobox protein HD1-like
SwissprotQ9FPQ81e-161KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0A0KKD31e-171A0A0A0KKD3_CUCSA; Uncharacterized protein
STRINGGLYMA11G02960.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67732329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-148KNOTTED-like homeobox of Arabidopsis thaliana 7